PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn073421
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family NAC
Protein Properties Length: 258aa    MW: 29971.6 Da    PI: 8.0341
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn073421genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM143.21.5e-4461362128
         NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                  pGfrF Pt+eelv++yL kk+eg++ +l+ v + +diyk++PwdLp+     ++++ ++w+fF++r++k+a+g r+nr t+sgyWkatg+   v+s++
  Achn073421   6 RPGFRFYPTEEELVSFYLPKKLEGTRQDLDLVTPVLDIYKFNPWDLPQyagkLCRKDPEQWFFFIPRQEKEARGGRPNRLTTSGYWKATGSPGYVYSSD 104
                 79************************9996667777***********645543344667**************************************** PP

         NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                 ++ +g+k+t+vfykgrap+g+kt W m+eyr+
  Achn073421 105 SRIIGVKRTMVFYKGRAPTGRKTVWKMNEYRA 136
                 ******************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.02E-494163IPR003441NAC domain
PROSITE profilePS5100549.1785163IPR003441NAC domain
PfamPF023652.3E-227135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MEEDLRPGFR FYPTEEELVS FYLPKKLEGT RQDLDLVTPV LDIYKFNPWD LPQYAGKLCR  60
KDPEQWFFFI PRQEKEARGG RPNRLTTSGY WKATGSPGYV YSSDSRIIGV KRTMVFYKGR  120
APTGRKTVWK MNEYRATEGE ASSSLSANPK LREEFSLCRV YIKSKCLRAF DRRPSASTTI  180
GTGDEMVNRH VQYQRSGQEM KRLADHNQTT ATSLDQSSAR DHEHPNSQTT EINDNWDMAV  240
DDNYDTVWEW DIMKYLL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-37216412169Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010245803.11e-104PREDICTED: NAC domain-containing protein 90-like
TrEMBLA0A061EV891e-101A0A061EV89_THECC; NAC domain containing protein 90
STRINGVIT_08s0007g02940.t013e-96(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24942357
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44350.21e-80NAC domain containing protein 61